Anti-PSMG4

Catalog Number: ATA-HPA074376
Article Name: Anti-PSMG4
Biozol Catalog Number: ATA-HPA074376
Supplier Catalog Number: HPA074376
Alternative Catalog Number: ATA-HPA074376-100,ATA-HPA074376-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C6orf86, PAC4
Clonality: Polyclonal
Isotype: IgG
NCBI: 389362
UniProt: Q5JS54
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGDTSDT
Target: PSMG4
Antibody Type: Monoclonal Antibody
HPA074376-100ul