Anti-KCNA1

Catalog Number: ATA-HPA074471
Article Name: Anti-KCNA1
Biozol Catalog Number: ATA-HPA074471
Supplier Catalog Number: HPA074471
Alternative Catalog Number: ATA-HPA074471-100,ATA-HPA074471-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: AEMK, HUK1, Kv1.1, MBK1, RBK1
Clonality: Polyclonal
Isotype: IgG
NCBI: 3736
UniProt: Q09470
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTD
Target: KCNA1
Antibody Type: Monoclonal Antibody
HPA074471-100ul