Anti-MYCL

Catalog Number: ATA-HPA074515
Article Name: Anti-MYCL
Biozol Catalog Number: ATA-HPA074515
Supplier Catalog Number: HPA074515
Alternative Catalog Number: ATA-HPA074515-100,ATA-HPA074515-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bHLHe38, LMYC, MYCL1
Clonality: Polyclonal
Isotype: IgG
NCBI: 4610
UniProt: P12524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MCVCAGCRVSPSRRGAGPLQVAGGWSEGADMDYDSYQHYFY
Target: MYCL
Antibody Type: Monoclonal Antibody
HPA074515-100ul