Anti-SDHAF1

Catalog Number: ATA-HPA074563
Article Name: Anti-SDHAF1
Biozol Catalog Number: ATA-HPA074563
Supplier Catalog Number: HPA074563
Alternative Catalog Number: ATA-HPA074563-100,ATA-HPA074563-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: LYRM8
Clonality: Polyclonal
Concentration: 0,4
NCBI: 644096
UniProt: A6NFY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QRQVLSLYRDLLRAGRGKPGAEARVRAEFRQHAGLPRSDVLRIEYLYRRGRRQLQLLR
Target: SDHAF1
HPA074563-100ul