Anti-GALR1

Catalog Number: ATA-HPA074584
Article Name: Anti-GALR1
Biozol Catalog Number: ATA-HPA074584
Supplier Catalog Number: HPA074584
Alternative Catalog Number: ATA-HPA074584-100,ATA-HPA074584-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GALNR, GALNR1
Clonality: Polyclonal
Isotype: IgG
NCBI: 2587
UniProt: P47211
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVT
Target: GALR1
Antibody Type: Monoclonal Antibody
HPA074584-100ul