Anti-GSPT1

Catalog Number: ATA-HPA074588
Article Name: Anti-GSPT1
Biozol Catalog Number: ATA-HPA074588
Supplier Catalog Number: HPA074588
Alternative Catalog Number: ATA-HPA074588-100,ATA-HPA074588-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: eRF3a, ETF3A, GST1
Clonality: Polyclonal
Isotype: IgG
NCBI: 2935
UniProt: P15170
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETE
Target: GSPT1
Antibody Type: Monoclonal Antibody
HPA074588-100ul