Anti-ZFP91

Catalog Number: ATA-HPA074591
Article Name: Anti-ZFP91
Biozol Catalog Number: ATA-HPA074591
Supplier Catalog Number: HPA074591
Alternative Catalog Number: ATA-HPA074591-100,ATA-HPA074591-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PZF, ZNF757
Clonality: Polyclonal
Concentration: 0,1
NCBI: 80829
UniProt: Q96JP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YCSGTERVSLMADGKIFVGSGSSGGTEGLVMNSDILGATTEVLIEDSDSAGP
Target: ZFP91
HPA074591-100ul