Anti-METTL27

Catalog Number: ATA-HPA074662
Article Name: Anti-METTL27
Biozol Catalog Number: ATA-HPA074662
Supplier Catalog Number: HPA074662
Alternative Catalog Number: ATA-HPA074662-100,ATA-HPA074662-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: WBSCR27
Clonality: Polyclonal
Isotype: IgG
NCBI: 155368
UniProt: Q8N6F8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPEL
Target: METTL27
Antibody Type: Monoclonal Antibody
HPA074662-100ul