Anti-SALL1

Catalog Number: ATA-HPA074673
Article Name: Anti-SALL1
Biozol Catalog Number: ATA-HPA074673
Supplier Catalog Number: HPA074673
Alternative Catalog Number: ATA-HPA074673-100,ATA-HPA074673-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Hsal1, TBS, ZNF794
Clonality: Polyclonal
Isotype: IgG
NCBI: 6299
UniProt: Q9NSC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ISESTSSMQALSPSNSTQEFHKSPSIEEKPQRAVPSEFANGLSPTPVNGGALDLTSSHAEK
Target: SALL1
Antibody Type: Monoclonal Antibody
HPA074673-100ul