Anti-PDE6A
Catalog Number:
ATA-HPA074677
- Images (8)
| Article Name: | Anti-PDE6A |
| Biozol Catalog Number: | ATA-HPA074677 |
| Supplier Catalog Number: | HPA074677 |
| Alternative Catalog Number: | ATA-HPA074677-100,ATA-HPA074677-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PDEA, RP43 |
| phosphodiesterase 6A |
| Anti-PDE6A |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 5145 |
| UniProt: | P16499 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQENLQTEKCIFNVM |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PDE6A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, eye, retina and lymph node using Anti-PDE6A antibody HPA074677 (A) shows similar protein distribution across tissues to independent antibody HPA016970 (B). |
|
|
Immunohistochemical staining of human colon using Anti-PDE6A antibody HPA074677. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-PDE6A antibody HPA074677. |
|
|
Immunohistochemical staining of human lymph node using Anti-PDE6A antibody HPA074677. |
|
|
Immunohistochemical staining of human eye, retina using Anti-PDE6A antibody HPA074677. |
|
|
HPA074677-100ul |
|
|
HPA074677-100ul |
|
|
HPA074677-100ul |
Product Guarantee and Expert Support
