Anti-CTNS

Catalog Number: ATA-HPA074687
Article Name: Anti-CTNS
Biozol Catalog Number: ATA-HPA074687
Supplier Catalog Number: HPA074687
Alternative Catalog Number: ATA-HPA074687-100,ATA-HPA074687-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CTNS-LSB, PQLC4, SLC66A4
Clonality: Polyclonal
Concentration: 0,05
NCBI: 1497
UniProt: O60931
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PDEVVVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRSSA
Target: CTNS
HPA074687-100ul