Anti-CHIT1

Catalog Number: ATA-HPA074844
Article Name: Anti-CHIT1
Biozol Catalog Number: ATA-HPA074844
Supplier Catalog Number: HPA074844
Alternative Catalog Number: ATA-HPA074844-100,ATA-HPA074844-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CHI3, CHIT
Clonality: Polyclonal
Isotype: IgG
NCBI: 1118
UniProt: Q13231
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEK
Target: CHIT1
Antibody Type: Monoclonal Antibody
HPA074844-100ul