Anti-TIAL1

Catalog Number: ATA-HPA074876
Article Name: Anti-TIAL1
Biozol Catalog Number: ATA-HPA074876
Supplier Catalog Number: HPA074876
Alternative Catalog Number: ATA-HPA074876-100,ATA-HPA074876-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: TIAR
Clonality: Polyclonal
Concentration: 0,05
NCBI: 7073
UniProt: Q01085
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QPWNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQT
Target: TIAL1
HPA074876-100ul