Anti-NELFCD

Catalog Number: ATA-HPA074936
Article Name: Anti-NELFCD
Biozol Catalog Number: ATA-HPA074936
Supplier Catalog Number: HPA074936
Alternative Catalog Number: ATA-HPA074936-100,ATA-HPA074936-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HSPC130, NELF-C, NELF-D, TH1, TH1L
Clonality: Polyclonal
Isotype: IgG
NCBI: 51497
UniProt: Q8IXH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCH
Target: NELFCD
Antibody Type: Monoclonal Antibody
HPA074936-100ul