Anti-ADRA2B

Catalog Number: ATA-HPA074948
Article Name: Anti-ADRA2B
Biozol Catalog Number: ATA-HPA074948
Supplier Catalog Number: HPA074948
Alternative Catalog Number: ATA-HPA074948-100,ATA-HPA074948-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ADRA2L1, ADRA2RL1, ADRARL1
Clonality: Polyclonal
Isotype: IgG
NCBI: 151
UniProt: P18089
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTF
Target: ADRA2B
Antibody Type: Monoclonal Antibody
HPA074948-100ul