Anti-SIPA1L3

Catalog Number: ATA-HPA074988
Article Name: Anti-SIPA1L3
Biozol Catalog Number: ATA-HPA074988
Supplier Catalog Number: HPA074988
Alternative Catalog Number: ATA-HPA074988-100,ATA-HPA074988-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0545
Clonality: Polyclonal
Isotype: IgG
NCBI: 23094
UniProt: O60292
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QPSGSFSTPGSATYVRYKPSPERYTAAPHPLLSLDPHFSHDGTSSGDSSSGGLTSQESTMERQKPEPLWHVPAQARLSAIAGSSGNKHPSR
Target: SIPA1L3
Antibody Type: Monoclonal Antibody
HPA074988-100ul