Anti-BRF1

Catalog Number: ATA-HPA074990
Article Name: Anti-BRF1
Biozol Catalog Number: ATA-HPA074990
Supplier Catalog Number: HPA074990
Alternative Catalog Number: ATA-HPA074990-100,ATA-HPA074990-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BRF, GTF3B, hBRF, TAF3B2, TAF3C, TFIIIB90
Clonality: Polyclonal
Isotype: IgG
NCBI: 2972
UniProt: Q92994
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAEYLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQ
Target: BRF1
Antibody Type: Monoclonal Antibody
HPA074990-100ul