Anti-GUCA1A

Catalog Number: ATA-HPA075056
Article Name: Anti-GUCA1A
Biozol Catalog Number: ATA-HPA075056
Supplier Catalog Number: HPA075056
Alternative Catalog Number: ATA-HPA075056-100,ATA-HPA075056-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C6orf131, COD3, CORD14, dJ139D8.6, GCAP, GCAP1, GUCA, GUCA1
Clonality: Polyclonal
Isotype: IgG
NCBI: 2978
UniProt: P43080
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGY
Target: GUCA1A
Antibody Type: Monoclonal Antibody
HPA075056-100ul