Anti-SCG2

Product Overview

• Article Name: Anti-SCG2
• Biozol Catalog Number: ATA-HPA075062
• Supplier Catalog Number: HPA075062
• Alternative Catalog Number: ATA-HPA075062-100,ATA-HPA075062-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Sonstiges
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CHGC, SgII, SN

Product Description

secretogranin II

Additional Information

Anti-SCG2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.4 mg/ml
• Isotype: IgG
• NCBI: 7857
• UniProt: P13521
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: NPVEEKIESQTQEEVRDSKENIEKNEQINDEMKRSGQLGIQEEDLRKESKDQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERA
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SCG2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:5000 - 1:10000

Images

Immunohistochemistry analysis in human adrenal gland and liver tissues using Anti-SCG2 antibody. Corresponding SCG2 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human adrenal gland, cerebral cortex, lymph node and pituitary gland using Anti-SCG2 antibody HPA075062 (A) shows similar protein distribution across tissues to independent antibody HPA011893 (B).

Immunohistochemical staining of human liver shows low expression as expected.

Immunohistochemical staining of human adrenal gland shows high expression.

Immunohistochemical staining of human cerebral cortex using Anti-SCG2 antibody HPA075062.

Immunohistochemical staining of human lymph node using Anti-SCG2 antibody HPA075062.

Immunohistochemical staining of human pituitary gland using Anti-SCG2 antibody HPA075062.

HPA075062-100ul

HPA075062-100ul

HPA075062-100ul