Anti-ZNF641

Catalog Number: ATA-HPA075069
Article Name: Anti-ZNF641
Biozol Catalog Number: ATA-HPA075069
Supplier Catalog Number: HPA075069
Alternative Catalog Number: ATA-HPA075069-100,ATA-HPA075069-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ31295
Clonality: Polyclonal
Concentration: 0,1
NCBI: 121274
UniProt: Q96N77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DTVLWNPEHDESWDSMPSSSRGMLLGPPFLQEDSFSNLLCSTEMDSLLRPHTCPQCGKQFVW
Target: ZNF641
HPA075069-100ul