Anti-GRK7

Catalog Number: ATA-HPA075093
Article Name: Anti-GRK7
Biozol Catalog Number: ATA-HPA075093
Supplier Catalog Number: HPA075093
Alternative Catalog Number: ATA-HPA075093-100,ATA-HPA075093-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GPRK7
Clonality: Polyclonal
Isotype: IgG
NCBI: 131890
UniProt: Q8WTQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DPSVVYAKDIAEIDDFSEVRGVEFDDKDKQFFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCEEGNSSKSG
Target: GRK7
Antibody Type: Monoclonal Antibody
HPA075093-100ul