Anti-KMT5C

Catalog Number: ATA-HPA075095
Article Name: Anti-KMT5C
Biozol Catalog Number: ATA-HPA075095
Supplier Catalog Number: HPA075095
Alternative Catalog Number: ATA-HPA075095-100,ATA-HPA075095-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC2705, SUV420H2
Clonality: Polyclonal
Concentration: 0,05
NCBI: 84787
UniProt: Q86Y97
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: THKMNVSPVPPLRRQQHLRSALETFLRQRDLEAAYRALTLGGWTARYFQSR
Target: KMT5C
HPA075095-100ul