Anti-BBOF1

Catalog Number: ATA-HPA075108
Article Name: Anti-BBOF1
Biozol Catalog Number: ATA-HPA075108
Supplier Catalog Number: HPA075108
Alternative Catalog Number: ATA-HPA075108-100,ATA-HPA075108-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C14orf45, CCDC176
Clonality: Polyclonal
Isotype: IgG
NCBI: 80127
UniProt: Q8ND07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ERAHHEAIVQLNDAGRNVFKENVYLQKALAYHLKETDALQKNSQKLQESHTLLLHQKEINDLLVKEKIMQLVQQRSQIQTLQKKVVNLETALSYMTKEFESEVLKLQQHAMIENQAGQVEIDKLQHLLQMKDREMNRVKK
Target: BBOF1
Antibody Type: Monoclonal Antibody
HPA075108-100ul