Anti-FGGY

Catalog Number: ATA-HPA075137
Article Name: Anti-FGGY
Biozol Catalog Number: ATA-HPA075137
Supplier Catalog Number: HPA075137
Alternative Catalog Number: ATA-HPA075137-100,ATA-HPA075137-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ10986
Clonality: Polyclonal
Concentration: 0,1
NCBI: 55277
UniProt: Q96C11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAA
Target: FGGY
HPA075137-100ul