Anti-SYTL4

Catalog Number: ATA-HPA075138
Article Name: Anti-SYTL4
Biozol Catalog Number: ATA-HPA075138
Supplier Catalog Number: HPA075138
Alternative Catalog Number: ATA-HPA075138-100,ATA-HPA075138-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 94121
UniProt: Q96C24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGEGGELQVWIK
Target: SYTL4
Antibody Type: Monoclonal Antibody
HPA075138-100ul