Anti-PNPLA2

Catalog Number: ATA-HPA075175
Article Name: Anti-PNPLA2
Biozol Catalog Number: ATA-HPA075175
Supplier Catalog Number: HPA075175
Alternative Catalog Number: ATA-HPA075175-100,ATA-HPA075175-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ATGL, desnutrin, FP17548, iPLA2zeta, TTS-2.2
Clonality: Polyclonal
Isotype: IgG
NCBI: 57104
UniProt: Q96AD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FSGESDICPQDSSTNIHELRVTNTSIQFNLRNLYRLSKALFPPEPLVLREMCKQGYRDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQA
Target: PNPLA2
Antibody Type: Monoclonal Antibody
HPA075175-100ul