Anti-CAMK2N2

Catalog Number: ATA-HPA075200
Article Name: Anti-CAMK2N2
Biozol Catalog Number: ATA-HPA075200
Supplier Catalog Number: HPA075200
Alternative Catalog Number: ATA-HPA075200-100,ATA-HPA075200-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CaM-KIIN
Clonality: Polyclonal
Isotype: IgG
NCBI: 94032
UniProt: Q96S95
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AKRPPKLGQIGRAKRVVIEDDRIDDVLKGM
Target: CAMK2N2
Antibody Type: Monoclonal Antibody
HPA075200-100ul