Anti-TOGARAM2

Catalog Number: ATA-HPA075216
Article Name: Anti-TOGARAM2
Biozol Catalog Number: ATA-HPA075216
Supplier Catalog Number: HPA075216
Alternative Catalog Number: ATA-HPA075216-100,ATA-HPA075216-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Crescerin-2, FAM179A, FLJ43249, LOC165186
Clonality: Polyclonal
Isotype: IgG
NCBI: 165186
UniProt: Q6ZUX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FSNPELGLRDALQCLNSSDWQMKEKGLVSIQRLAACHSEVLTGKLHDVCLAVTGEVTNLRSKVSHLAISTLGDLFQALKKNMDQ
Target: TOGARAM2
Antibody Type: Monoclonal Antibody
HPA075216-100ul