Anti-CRLF2

Catalog Number: ATA-HPA075272
Article Name: Anti-CRLF2
Biozol Catalog Number: ATA-HPA075272
Supplier Catalog Number: HPA075272
Alternative Catalog Number: ATA-HPA075272-100,ATA-HPA075272-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CRL2, TSLPR
Clonality: Polyclonal
Concentration: 0,5
NCBI: 64109
UniProt: Q9HC73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK
Target: CRLF2
HPA075272-100ul