Anti-HARS2

Catalog Number: ATA-HPA075303
Article Name: Anti-HARS2
Biozol Catalog Number: ATA-HPA075303
Supplier Catalog Number: HPA075303
Alternative Catalog Number: ATA-HPA075303-100,ATA-HPA075303-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HARSL, HARSR, HO3
Clonality: Polyclonal
Concentration: 0,05
NCBI: 23438
UniProt: P49590
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LAMNKVKKMKRYHVGKVWRRESPTIVQGRYRE
Target: HARS2
HPA075303-100ul