Anti-HAND1

Catalog Number: ATA-HPA075313
Article Name: Anti-HAND1
Biozol Catalog Number: ATA-HPA075313
Supplier Catalog Number: HPA075313
Alternative Catalog Number: ATA-HPA075313-100,ATA-HPA075313-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bHLHa27, eHand, Hxt, Thing1
Clonality: Polyclonal
Concentration: 0,05
NCBI: 9421
UniProt: O96004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: HPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFP
Target: HAND1
HPA075313-100ul