Anti-MAP3K7

Catalog Number: ATA-HPA075335
Article Name: Anti-MAP3K7
Biozol Catalog Number: ATA-HPA075335
Supplier Catalog Number: HPA075335
Alternative Catalog Number: ATA-HPA075335-100,ATA-HPA075335-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MEKK7, TAK1
Clonality: Polyclonal
Isotype: IgG
NCBI: 6885
UniProt: O43318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGNILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQ
Target: MAP3K7
Antibody Type: Monoclonal Antibody
HPA075335-100ul