Anti-CRISPLD2

Catalog Number: ATA-HPA075372
Article Name: Anti-CRISPLD2
Biozol Catalog Number: ATA-HPA075372
Supplier Catalog Number: HPA075372
Alternative Catalog Number: ATA-HPA075372-100,ATA-HPA075372-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZP434B044, LCRISP2, LGL1
Clonality: Polyclonal
Concentration: 0,1
NCBI: 83716
UniProt: Q9H0B8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YLLPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEILMLHNKLRGQVQPQASN
Target: CRISPLD2
HPA075372-100ul