Anti-ALS2

Catalog Number: ATA-HPA075409
Article Name: Anti-ALS2
Biozol Catalog Number: ATA-HPA075409
Supplier Catalog Number: HPA075409
Alternative Catalog Number: ATA-HPA075409-100,ATA-HPA075409-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ALS2CR6
Clonality: Polyclonal
Concentration: 0,05
NCBI: 57679
UniProt: Q96Q42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LGFWKTFPGKMTDSLRKPERRLLCESSNRALSLQHAGRFSVNWFILFNDALVHAQFSTHHVFPLATLWAEPLSEEAGGVN
Target: ALS2
HPA075409-100ul