Anti-IPP

Catalog Number: ATA-HPA075545
Article Name: Anti-IPP
Biozol Catalog Number: ATA-HPA075545
Supplier Catalog Number: HPA075545
Alternative Catalog Number: ATA-HPA075545-100,ATA-HPA075545-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KLHL27
Clonality: Polyclonal
Isotype: IgG
NCBI: 3652
UniProt: Q9Y573
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SGLGVTVLGGMVYAIGGEKDSMIFDCTECYDPVTKQWTTVASMNHPRCGLGVCVCYGAIYALGGWVGAEIGNTIERFDPD
Target: IPP
Antibody Type: Monoclonal Antibody
HPA075545-100ul