Anti-FRG1

Catalog Number: ATA-HPA075683
Article Name: Anti-FRG1
Biozol Catalog Number: ATA-HPA075683
Supplier Catalog Number: HPA075683
Alternative Catalog Number: ATA-HPA075683-100,ATA-HPA075683-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FRG1A, FSG1
Clonality: Polyclonal
Isotype: IgG
NCBI: 2483
UniProt: Q14331
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: REEHEETQLDIVGIWWTVTNFGEISGTIAIEMDKGTYIH
Target: FRG1
Antibody Type: Monoclonal Antibody
HPA075683-100ul