Anti-RUNDC3B

Catalog Number: ATA-HPA075760
Article Name: Anti-RUNDC3B
Biozol Catalog Number: ATA-HPA075760
Supplier Catalog Number: HPA075760
Alternative Catalog Number: ATA-HPA075760-100,ATA-HPA075760-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: RPIB9, RPIP9
Clonality: Polyclonal
Isotype: IgG
NCBI: 154661
UniProt: Q96NL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NQLSESVSQNKILLQRIEDSDLAHKLEKEQLEYIIVELQDQLTVLKNNDLRSRQELTAHLTNQWPSPGALDVNAVALDTLLYRKHNKQW
Target: RUNDC3B
Antibody Type: Monoclonal Antibody
HPA075760-100ul