Anti-VPS53

Catalog Number: ATA-HPA075763
Article Name: Anti-VPS53
Biozol Catalog Number: ATA-HPA075763
Supplier Catalog Number: HPA075763
Alternative Catalog Number: ATA-HPA075763-100,ATA-HPA075763-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Alternative Names: FLJ10979, HCCS1
Rabbit Polyclonal VPS53 Antibody against Human VPS53 subunit of GARP complex. Validated for Western Blot
Clonality: Polyclonal
Concentration: 0.1
NCBI: 55275
UniProt: Q5VIR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Sequence: TRDIKQLDHAKRHLTTSITTLNHLHMLAGGVDSLEAMTRRRQYGEVANLLQGVMNVLEHFHKYMGIPQIRQLSERVKAAQTELGQQILADFEEAFP
WB Image Caption 1