Anti-MSRA

Catalog Number: ATA-HPA075766
Article Name: Anti-MSRA
Biozol Catalog Number: ATA-HPA075766
Supplier Catalog Number: HPA075766
Alternative Catalog Number: ATA-HPA075766-100,ATA-HPA075766-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 4482
UniProt: Q9UJ68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSTIYPTS
Target: MSRA
Antibody Type: Monoclonal Antibody
HPA075766-100ul