Anti-LRRC4C

Catalog Number: ATA-HPA075816
Article Name: Anti-LRRC4C
Biozol Catalog Number: ATA-HPA075816
Supplier Catalog Number: HPA075816
Alternative Catalog Number: ATA-HPA075816-100,ATA-HPA075816-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA1580, NGL-1
Clonality: Polyclonal
Isotype: IgG
NCBI: 57689
UniProt: Q9HCJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKD
Target: LRRC4C
Antibody Type: Monoclonal Antibody
HPA075816-100ul