Anti-FAM228A

Catalog Number: ATA-HPA075817
Article Name: Anti-FAM228A
Biozol Catalog Number: ATA-HPA075817
Supplier Catalog Number: HPA075817
Alternative Catalog Number: ATA-HPA075817-100,ATA-HPA075817-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C2orf84, FLJ30851
Clonality: Polyclonal
Concentration: 0,05
NCBI: 653140
UniProt: Q86W67
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FTFTSHCVIPKEWHKASARARSKTYKYSPEKLIYADKKQKRKEKKTADLSQAAFERQFLSSKLSQKNKVGERKGLVSRGLGRGWHAGLCSTHE
Target: FAM228A
HPA075817-100ul