Anti-KCNK9

Catalog Number: ATA-HPA075842
Article Name: Anti-KCNK9
Biozol Catalog Number: ATA-HPA075842
Supplier Catalog Number: HPA075842
Alternative Catalog Number: ATA-HPA075842-100,ATA-HPA075842-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: K2p9.1, TASK-3, TASK3
Clonality: Polyclonal
Isotype: IgG
NCBI: 51305
UniProt: Q9NPC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEP
Target: KCNK9
Antibody Type: Monoclonal Antibody
HPA075842-100ul