Anti-TMEM33

Catalog Number: ATA-HPA075863
Article Name: Anti-TMEM33
Biozol Catalog Number: ATA-HPA075863
Supplier Catalog Number: HPA075863
Alternative Catalog Number: ATA-HPA075863-100,ATA-HPA075863-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ10525
Clonality: Polyclonal
Isotype: IgG
NCBI: 55161
UniProt: P57088
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LHAATYTKKVLDARGSNSLPLLRSVLDKLSANQQ
Target: TMEM33
Antibody Type: Monoclonal Antibody
HPA075863-100ul