Anti-TBX3

Catalog Number: ATA-HPA075876
Article Name: Anti-TBX3
Biozol Catalog Number: ATA-HPA075876
Supplier Catalog Number: HPA075876
Alternative Catalog Number: ATA-HPA075876-100,ATA-HPA075876-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: TBX3-ISO, UMS, XHL
Clonality: Polyclonal
Isotype: IgG
NCBI: 6926
UniProt: O15119
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNGAAALSLPGALAKPIMDQLVGAAETGIPFSSLGPQAHLRPLKTMEP
Target: TBX3
Antibody Type: Monoclonal Antibody
HPA075876-100ul