Anti-LRRCC1

Catalog Number: ATA-HPA075880
Article Name: Anti-LRRCC1
Biozol Catalog Number: ATA-HPA075880
Supplier Catalog Number: HPA075880
Alternative Catalog Number: ATA-HPA075880-100,ATA-HPA075880-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CLERC, KIAA1764, VFL1
Clonality: Polyclonal
Isotype: IgG
NCBI: 85444
UniProt: Q9C099
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KIPYDAKTIQTIKHHNKNYNSFVSCNRKMKPPYLKELYVSSSLANCPMLQESEKPKTEIIKVDQSHSEDNTYQSLVEQLDQEREKRWRAEQAENK
Target: LRRCC1
Antibody Type: Monoclonal Antibody
HPA075880-100ul