Anti-ARHGAP17

Catalog Number: ATA-HPA075891
Article Name: Anti-ARHGAP17
Biozol Catalog Number: ATA-HPA075891
Supplier Catalog Number: HPA075891
Alternative Catalog Number: ATA-HPA075891-100,ATA-HPA075891-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ10308, FLJ13219, NADRIN, RICH1, WBP15
Clonality: Polyclonal
Concentration: 0,05
NCBI: 55114
UniProt: Q68EM7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VPKPRNRPSVPPPPQPPGVHSAGDSSLTNTAPTASKIVTDSNSRVSEPHRSIFPEMHSDSASKDVPGRILL
Target: ARHGAP17
HPA075891-100ul