Anti-RETREG2

Catalog Number: ATA-HPA075910
Article Name: Anti-RETREG2
Biozol Catalog Number: ATA-HPA075910
Supplier Catalog Number: HPA075910
Alternative Catalog Number: ATA-HPA075910-100,ATA-HPA075910-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C2orf17, FAM134A, MAG-2, MGC3035
Clonality: Polyclonal
Concentration: 0,05
NCBI: 79137
UniProt: Q8NC44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LIQRMYTRLEPLLMQLDYSMKAEANALHHKHDKRKRQGKNAPPGGDEPLAETES
Target: RETREG2
HPA075910-100ul