Anti-CEMP1

Catalog Number: ATA-HPA075926
Article Name: Anti-CEMP1
Biozol Catalog Number: ATA-HPA075926
Supplier Catalog Number: HPA075926
Alternative Catalog Number: ATA-HPA075926-100,ATA-HPA075926-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CP-23
Clonality: Polyclonal
Isotype: IgG
NCBI: 752014
UniProt: Q6PRD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: CPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPP
Target: CEMP1
Antibody Type: Monoclonal Antibody
HPA075926-100ul