Anti-DHRSX

Catalog Number: ATA-HPA075955
Article Name: Anti-DHRSX
Biozol Catalog Number: ATA-HPA075955
Supplier Catalog Number: HPA075955
Alternative Catalog Number: ATA-HPA075955-100,ATA-HPA075955-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DHRS5X, DHRS5Y, DHRSXY, DHRSY, SDR46C1, SDR7C6
Clonality: Polyclonal
Isotype: IgG
NCBI: 207063
UniProt: Q8N5I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLAL
Target: DHRSX
Antibody Type: Monoclonal Antibody
HPA075955-100ul