Anti-KCNA7

Catalog Number: ATA-HPA075990
Article Name: Anti-KCNA7
Biozol Catalog Number: ATA-HPA075990
Supplier Catalog Number: HPA075990
Alternative Catalog Number: ATA-HPA075990-100,ATA-HPA075990-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HAK6, Kv1.7
Clonality: Polyclonal
Concentration: 0,3
NCBI: 3743
UniProt: Q96RP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TEGEEAGMFSHVDMQPCGPLEGKANGGLVDGEV
Target: KCNA7
HPA075990-100ul